Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. scored 68/100 — Use Caution.
CheckIt score 68/100. contains soybean oil, sunflower oil.
✅ No common allergens detected
soybean oil sunflower oil
Roasted Potatoes, Broccoli, Herb Coated Cooked Chicken (Chicken Breast, Water, Olive Oil, Less Than 2% Of: Isolated Soy Protein Product [Isolated Soy Protein, Modified Potato Starch, Corn Starch, Carrageenan, Soy Lecithin], Salt, Dextrose, Maltodextrin, Garlic Powder, Potassium Chloride, Sodium Phosphate, Onion Powder, Black Pepper, Parsley, Ground Celery Seed, Thyme, Flavoring), Soybean Oil, Rosemary Brown Butter Seasoning (Salt, Sugar, Brown Sugar, Maltodextrin, Nonfat Dry Milk, Garlic Powder, Spice, Butter [Cream, Annatto], Whey Powder, Onion Powder, Buttermilk Powder, Sunflower Oil, Modified Corn Starch, Medium Chain Triglycerides, Natural Flavor, Disodium Phosphate). CONTAINS: MILK, SOY
| Product | Brand | Score |
|---|---|---|
| P.F. Chang's Home Menu General Chang's Chicken Skillet Meal, Frozen Meal, 22 oz. | Conagra Brands, Inc | 73/100 |
Join health-conscious shoppers. Every week: worst products to avoid, cleanest new finds, and FDA recall alerts.
No spam. Unsubscribe anytime.
See what's really in your food
Scan any food label instantly. No barcode needed. 26,000+ products scored.
Download Free on the App Store →Free · No credit card required · Works on iPhone & Android
CheckIt AI. (2026). "Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI". Climaverse PBC. Retrieved from https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d"Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI." CheckIt AI, Climaverse PBC, 2026-03-12. https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d.<a href="https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d">Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI — CheckIt AI</a>@misc{checkit2026isithealthyconagrabrandsincbirdseyesheetpanmealschickenwithrosemarybrownbutterpotatoesfrozenmeal117e2d,
title = {Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI},
author = {CheckIt AI},
year = {2026},
publisher = {Climaverse PBC},
url = {https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d},
note = {Retrieved 2026-03-12}
}