Is Fried garlic chicken flavored ramen Healthy?

Fried garlic chicken flavored ramen scored 88/100 — Generally Healthy.

CheckIt score 88/100. contains sunflower oil.

Fried garlic chicken flavored ramen Scan Fried garlic chicken flavored ramen in the App →

⚠️ Allergen Warnings

gluten sesame seeds soybeans

🛢️ Seed Oils Found

sunflower oil

📱 Want to check this yourself? Scan any product in seconds.

Get CheckIt AI Free → ★4.7 · 229+ reviews

⚠️ Flagged Additives

e477 e500 e500i e501 e501i

Full Ingredients List

wheat flour, chicken broth*, sunflower oil, inulin*, potato starch, whey protein concentrate, sesame flour, garlic*, chicken fat* 200 contains less than 2% of: beef collage yeast extracts, chicken salt, soy sauce powder 6% (soybeans, wheat), green onion*, onion*, cabbage*, mushroom*, spices, propylene glycol esters of fatty acids, 5% facts ainer (48g) % daily value* 2% 19% mono-diglycerides, brine (sodium carbonate, potassium carbonate), 11% sea salt, sesame oil, rosemary 11% extract, *dried 0% contains milk, sesame, soy and 13% wheat, 0% 2% 4% 4% a nutrient in a de 2,000 calories

Nutrition Facts

📬

Get Your Free Weekly Clean Food Guide

Join health-conscious shoppers. Every week: worst products to avoid, cleanest new finds, and FDA recall alerts.

No spam. Unsubscribe anytime.

📬

Get Your Free Weekly Clean Food Guide

Join health-conscious shoppers. Every week: worst products to avoid, cleanest new finds, and FDA recall alerts.

No spam. Unsubscribe anytime.

Frequently Asked Questions

Is Fried garlic chicken flavored ramen healthy?
Fried garlic chicken flavored ramen scored 88/100 on CheckIt AI's health analysis. Generally Healthy. CheckIt score 88/100. contains sunflower oil.
What allergens does Fried garlic chicken flavored ramen contain?
Fried garlic chicken flavored ramen contains: gluten, sesame seeds, soybeans.
Does Fried garlic chicken flavored ramen contain seed oils?
Yes, Fried garlic chicken flavored ramen contains: sunflower oil.
Does Fried garlic chicken flavored ramen have artificial additives?
Yes, Fried garlic chicken flavored ramen contains these flagged additives: e477, e500, e500i, e501, e501i.
What is the healthiest alternative to Fried garlic chicken flavored ramen?
Check the CheckIt AI app for personalized alternative recommendations.
CheckIt AI
CheckIt AI
★★★★★ 4.7 · 229+ reviews

What's really in your food? Find out in 2 seconds.

1,496 products scanned today · Point your camera at any label

Try It Free →

Free forever · No credit card · Works on iPhone & Android

📋 Cite This Data
APACheckIt AI. (2026). "Is Fried garlic chicken flavored ramen Healthy? Score: 88/100 | CheckIt AI". Climaverse PBC. Retrieved from https://getcheck.it/is-it-healthy/nutrisystem-fried-garlic-chicken-flavored-ramen-5bbb8b
MLA"Is Fried garlic chicken flavored ramen Healthy? Score: 88/100 | CheckIt AI." CheckIt AI, Climaverse PBC, 2026-03-26. https://getcheck.it/is-it-healthy/nutrisystem-fried-garlic-chicken-flavored-ramen-5bbb8b.
HTML Embed<a href="https://getcheck.it/is-it-healthy/nutrisystem-fried-garlic-chicken-flavored-ramen-5bbb8b">Is Fried garlic chicken flavored ramen Healthy? Score: 88/100 | CheckIt AI — CheckIt AI</a>
BibTeX@misc{checkit2026isithealthynutrisystemfriedgarlicchickenflavoredramen5bbb8b, title = {Is Fried garlic chicken flavored ramen Healthy? Score: 88/100 | CheckIt AI}, author = {CheckIt AI}, year = {2026}, publisher = {Climaverse PBC}, url = {https://getcheck.it/is-it-healthy/nutrisystem-fried-garlic-chicken-flavored-ramen-5bbb8b}, note = {Retrieved 2026-03-26} }