Buldak Artificial Spicy Chicken Flavor Ramen scored 35/100 — Not Recommended.
Loaded with artificial flavors and unhealthy oils, this ramen is a health-conscious consumer's nightmare. Avoid the artificial chicken flavor powder!
Scan Buldak Artificial Spicy Chicken Flavor Ramen in the App →
gluten dairy soy
palm oil
artificial chicken flavor powder disodium inosinate disodium guanylate
enriched flour, wheat flour, niacin, reduced iron, thiamine mononitrate, riboflavin, folic acid, vegetable oil, food starch-modified, palm oil, wheat gluten, salt, glycerin, yeast, color, sauce: water, cheese sauce, mozzarella cheese, milk, cheese cultures, salt, enzymes, whey, yeast extract, water, skim milk powder, sugar, soy sauce powder, soybeans, wheat, salt, garlic powder, artificial chicken flavor powder, maltodextrin, hydrolyzed soy protein, hydrolyzed corn protein, hydrolyzed wheat protein, onion, garlic, chili pepper oleoresin, color, flavor, disodium inosinate, disodium guanylate, sesame seeds, sesame oil, milk, cream
| Total Fat | 13g |
| Sodium | 1.023mg |
| Total Carbohydrates | 64g |
| Dietary Fiber | 2.2g |
| Sugars | 4.5g |
| Product | Brand | Score |
|---|---|---|
| apple banana strawberry with yogurt baby food puree | little JOURNEY | 100/100 |
| SOJA Sans sucres ajoutés | Carrefour BIO,Carrefour,Groupe Carrefour | 100/100 |
| Lentilles riz complet et soja sachet micro-ondable de 250g | U, U Bio | 100/100 |
| Peppermint Tea | Asda | 100/100 |
| Twinings Pure Peppermint x 80 | Twinings | 100/100 |
Join health-conscious shoppers. Every week: worst products to avoid, cleanest new finds, and FDA recall alerts.
No spam. Unsubscribe anytime.
See what's really in your food
Scan any food label instantly. No barcode needed. 26,000+ products scored.
Download Free on the App Store →Free · No credit card required · Works on iPhone & Android
CheckIt AI. (2026). "Is Buldak Artificial Spicy Chicken Flavor Ramen Healthy? Score: 35/100 | CheckIt AI". Climaverse PBC. Retrieved from https://getcheck.it/is-it-healthy/samyang-buldak-artificial-spicy-chicken-flavor-ramen-b442a2"Is Buldak Artificial Spicy Chicken Flavor Ramen Healthy? Score: 35/100 | CheckIt AI." CheckIt AI, Climaverse PBC, 2026-03-17. https://getcheck.it/is-it-healthy/samyang-buldak-artificial-spicy-chicken-flavor-ramen-b442a2.<a href="https://getcheck.it/is-it-healthy/samyang-buldak-artificial-spicy-chicken-flavor-ramen-b442a2">Is Buldak Artificial Spicy Chicken Flavor Ramen Healthy? Score: 35/100 | CheckIt AI — CheckIt AI</a>@misc{checkit2026isithealthysamyangbuldakartificialspicychickenflavorramenb442a2,
title = {Is Buldak Artificial Spicy Chicken Flavor Ramen Healthy? Score: 35/100 | CheckIt AI},
author = {CheckIt AI},
year = {2026},
publisher = {Climaverse PBC},
url = {https://getcheck.it/is-it-healthy/samyang-buldak-artificial-spicy-chicken-flavor-ramen-b442a2},
note = {Retrieved 2026-03-17}
}