Wondering whether Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT or Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS is the healthier choice? We analyzed every ingredient in both products to find out.
Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT is the healthier choice with a score of 90/100 compared to 46/100.
✅ Generally Safe
⚠️ Use Caution
Differences highlighted — ingredients unique to each product or flagged for safety concerns:
| Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT | Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS |
|---|---|
| ✓ enriched flour (wheat flour | — |
| ✓ niacin | — |
| ✓ whole wheat flour | — |
| ✓ soybean oil with tbhq and citric acid for freshness | — |
| ✓ contains 2% or less of each of the following: salt | — |
| ✓ leavening (baking soda | — |
| ✓ yeast) | — |
| ✓ caramel color | — |
| ✓ malted barley flour | — |
| ✓ sodium sulfite | — |
| ✓ enzymes. | — |
| — | ✓ enriched wheat flour (niacin |
| — | ✓ palm oil |
| — | ✓ rolled oats |
| — | ✓ wheat bran |
| — | ✓ salt |
| — | ✓ cornmeal |
| — | ✓ sesame |
| — | ✓ flaxseed |
| — | ✓ honey |
| — | ✓ malt syrup |
| — | ✓ sodium bicarbonate |
| — | ✓ ammonia bicarbonate |
| — | ✓ yeast |
| — | ✓ enzyme. |
CheckIt score 90/100. contains soybean oil.
Checkit score 46/100. Some concerns found.
Every Friday: the 5 worst products we found this week, FDA recall alerts, and the cleanest new finds at your grocery store.
Trusted by 27,000+ app users. No spam. Unsubscribe anytime.
Download CheckIt AI to scan and compare any two products side-by-side in the store. Get instant ingredient analysis, allergen detection, and personalized health scores.
Download CheckIt AI Free →Every Friday: the 5 worst products we found this week, FDA recall alerts, and the cleanest new finds at your grocery store.
Trusted by 27,000+ app users. No spam. Unsubscribe anytime.
Join 50,000+ families scanning smarter.
1,420 products scanned today · Point your camera at any label
Get the Free App →Free forever · No credit card · Works on iPhone & Android
CheckIt AI. (2026). "Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT vs Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS — Which Is Healthier? | CheckIt AI". Climaverse PBC. Retrieved from https://getcheck.it/vs/safeway-inc-wheat-saltine-crackers-wheat-fe214a--vs--rovira-biscuit-corporation-multigrain5-export-soda-crackers-b1f106"Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT vs Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS — Which Is Healthier? | CheckIt AI." CheckIt AI, Climaverse PBC, 2026-04-15. https://getcheck.it/vs/safeway-inc-wheat-saltine-crackers-wheat-fe214a--vs--rovira-biscuit-corporation-multigrain5-export-soda-crackers-b1f106.<a href="https://getcheck.it/vs/safeway-inc-wheat-saltine-crackers-wheat-fe214a--vs--rovira-biscuit-corporation-multigrain5-export-soda-crackers-b1f106">Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT vs Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS — Which Is Healthier? | CheckIt AI — CheckIt AI</a>@misc{checkit2026vssafewayincwheatsaltinecrackerswheatfe214avsrovirabiscuitcorporationmultigrain5exportsodacrackersb1f106,
title = {Safeway, Inc. WHEAT SALTINE CRACKERS, WHEAT vs Rovira Biscuit Corporation MULTIGRAIN5 EXPORT SODA CRACKERS — Which Is Healthier? | CheckIt AI},
author = {CheckIt AI},
year = {2026},
publisher = {Climaverse PBC},
url = {https://getcheck.it/vs/safeway-inc-wheat-saltine-crackers-wheat-fe214a--vs--rovira-biscuit-corporation-multigrain5-export-soda-crackers-b1f106},
note = {Retrieved 2026-04-15}
}